SCOPe 2.08: Domain d3ka1b_: 3ka1 B:

Lineage for d3ka1b_ (3ka1 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [311303] (1 PDB entry)

8. Domain d3ka1b_: 3ka1 B: [305687]
   automated match to d2py8c_
   complexed with act, hez

Details for d3ka1b_

PDB Entry: 3ka1, 1.71 Å

PDB Description: Crystal structure of RbcX from Thermosynechococcus elongatus

PDB Compounds: (B:) RbcX protein

SCOPe Domain Sequences for d3ka1b_:

Sequence; same for both SEQRES and ATOM records:

>d3ka1b_ a.280.1.1 (B:) RuBisCo chaperone RbcX {Thermosynechococcus elongatus [TaxId: 197221]}
dvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgerylealf
reqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqle

Timeline for d3ka1b_:

• d3ka1b_ first appeared in SCOPe 2.06
  
• d3ka1b_ appears in SCOPe 2.07