SCOPe 2.08: Domain d3k95b1: 3k95 B:3-337

Lineage for d3k95b1 (3k95 B:3-337)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [255872] (3 PDB entries)

8. Domain d3k95b1: 3k95 B:3-337 [305683]
   Other proteins in same PDB: d3k95a3, d3k95b3
   automated match to d3m49a1
   complexed with acy, btb, cl, fmt, gol, mg, peg, pg5, so4, tdp

Details for d3k95b1

PDB Entry: 3k95, 2 Å

PDB Description: crystal structure of transketolase complexed with thiamine diphosphate from bacillus anthracis

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d3k95b1:

Sequence; same for both SEQRES and ATOM records:

>d3k95b1 c.36.1.0 (B:3-337) automated matches {Bacillus anthracis [TaxId: 261594]}
hsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrf
vlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgi
atavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvv
lydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrptl
ievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktvq
dvgetaqaewntmlgeyaqaypelanelqaamngl

Timeline for d3k95b1:

• d3k95b1 first appeared in SCOPe 2.06
  
• d3k95b1 appears in SCOPe 2.07