| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Domain d1lvla2: 1lvl A:151-265 [30568] Other proteins in same PDB: d1lvla1, d1lvla3 complexed with fad, nad |
PDB Entry: 1lvl (more details), 2.45 Å
SCOPe Domain Sequences for d1lvla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase, middle domain {Pseudomonas putida [TaxId: 303]}
mlplggpvisstealapkalpqhlvvvgggyiglelgiayrklgaqvsvvearerilpty
dseltapvaeslkklgialhlghsvegyengcllandgkggqlrleadrvlvavg
Timeline for d1lvla2: