Lineage for d3k78a_ (3k78 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975572Species Betula pendula [TaxId:3505] [195294] (4 PDB entries)
  8. 2975576Domain d3k78a_: 3k78 A: [305679]
    automated match to d1fm4a_

Details for d3k78a_

PDB Entry: 3k78 (more details), 2.8 Å

PDB Description: Crystal structure of bet v1 d
PDB Compounds: (A:) Major pollen allergen Bet v 1-D/H

SCOPe Domain Sequences for d3k78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k78a_ d.129.3.1 (A:) automated matches {Betula pendula [TaxId: 3505]}
vfnyeiettsvipaarlfkafildgdnlvpkvapqaissveniegnggpgtikkinfpeg
fpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnkyh
tkgnhevkaeqvkaskemgetllravesyllahsda

SCOPe Domain Coordinates for d3k78a_:

Click to download the PDB-style file with coordinates for d3k78a_.
(The format of our PDB-style files is described here.)

Timeline for d3k78a_: