![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) ![]() Unusual right-handed coiled coil noted in PubMed 20173764 |
![]() | Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins) |
![]() | Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [310950] (1 PDB entry) |
![]() | Domain d3k5bg_: 3k5b G: [305678] Other proteins in same PDB: d3k5ba1, d3k5ba2, d3k5be1, d3k5be2 |
PDB Entry: 3k5b (more details), 3.1 Å
SCOPe Domain Sequences for d3k5bg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k5bg_ h.1.37.1 (G:) V-type ATPase peripheral stalk subunit G coiled coil {Thermus thermophilus HB8 [TaxId: 300852]} glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae teallaryreraeaeakavrekamarldeavalvlkevlp
Timeline for d3k5bg_: