Lineage for d3k5be1 (3k5b E:78-188)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527763Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2527764Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2527765Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2527777Species Thermus thermophilus HB8 [TaxId:300852] [310946] (1 PDB entry)
  8. 2527779Domain d3k5be1: 3k5b E:78-188 [305676]
    Other proteins in same PDB: d3k5ba2, d3k5bb_, d3k5be2, d3k5bg_

Details for d3k5be1

PDB Entry: 3k5b (more details), 3.1 Å

PDB Description: Crystal structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase
PDB Compounds: (E:) V-type ATP synthase subunit E

SCOPe Domain Sequences for d3k5be1:

Sequence, based on SEQRES records: (download)

>d3k5be1 d.81.4.1 (E:78-188) V-type ATPase subunit E C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
evleevrrrvrealealpqkpewpevvrklalealealpgakalvanpedlphleamare
rgvelqaepalrlgvravgaegktqvensllarmdrawdamsskvaqalwg

Sequence, based on observed residues (ATOM records): (download)

>d3k5be1 d.81.4.1 (E:78-188) V-type ATPase subunit E C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
evleevrrrvrealealpqkpewpevvrklalealealpgakalvanpedlphleamare
rgvelepalrlgvravgaegktqvensllarmdrawdamsskvaqalwg

SCOPe Domain Coordinates for d3k5be1:

Click to download the PDB-style file with coordinates for d3k5be1.
(The format of our PDB-style files is described here.)

Timeline for d3k5be1: