SCOPe 2.08: Domain d3k5bb_: 3k5b B:

Lineage for d3k5bb_ (3k5b B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family)
   Unusual right-handed coiled coil noted in PubMed 20173764

5. Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)

6. Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310950] (1 PDB entry)

8. Domain d3k5bb_: 3k5b B: [305675]
   Other proteins in same PDB: d3k5ba1, d3k5ba2, d3k5be1, d3k5be2

Details for d3k5bb_

PDB Entry: 3k5b, 3.1 Å

PDB Description: crystal structure of the peripheral stalk of thermus thermophilus h+- atpase/synthase

PDB Compounds: (B:) V-type ATP synthase, subunit (VAPC-THERM)

SCOPe Domain Sequences for d3k5bb_:

Sequence; same for both SEQRES and ATOM records:

>d3k5bb_ h.1.37.1 (B:) V-type ATPase peripheral stalk subunit G coiled coil {Thermus thermophilus HB8 [TaxId: 300852]}
glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae
teallaryreraeaeakavrekamarldeavalvlkevlp

Timeline for d3k5bb_:

• d3k5bb_ first appeared in SCOPe 2.06
  
• d3k5bb_ appears in SCOPe 2.07