Lineage for d1lvla1 (1lvl A:1-150,A:266-335)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833173Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 1833215Species Pseudomonas putida [TaxId:303] [51960] (1 PDB entry)
  8. 1833216Domain d1lvla1: 1lvl A:1-150,A:266-335 [30567]
    Other proteins in same PDB: d1lvla3
    complexed with fad, nad

Details for d1lvla1

PDB Entry: 1lvl (more details), 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}
qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq
fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv
ldgkqvevdgqriqcehlllatgsssvelpXrrprtkgfnlecldlkmngaaiaidercq
tsmhnvwaigdvagepmlahramaqgemvaeiiagkarrfe

SCOPe Domain Coordinates for d1lvla1:

Click to download the PDB-style file with coordinates for d1lvla1.
(The format of our PDB-style files is described here.)

Timeline for d1lvla1: