SCOP 1.63: Domain d1lvl_1: 1lvl 1-150,266-335

Lineage for d1lvl_1 (1lvl 1-150,266-335)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Dihydrolipoamide dehydrogenase [51959] (7 species)

7. Species Pseudomonas putida [TaxId:303] [51960] (1 PDB entry)

8. Domain d1lvl_1: 1lvl 1-150,266-335 [30567]
   Other proteins in same PDB: d1lvl_3

Details for d1lvl_1

PDB Entry: 1lvl, 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution

SCOP Domain Sequences for d1lvl_1:

Sequence; same for both SEQRES and ATOM records:

>d1lvl_1 c.3.1.5 (1-150,266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida}
qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq
fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv
ldgkqvevdgqriqcehlllatgsssvelpXrrprtkgfnlecldlkmngaaiaidercq
tsmhnvwaigdvagepmlahramaqgemvaeiiagkarrfe

Timeline for d1lvl_1:

• d1lvl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1lvl_1 appears in SCOP 1.61
  
• d1lvl_1 appears in SCOP 1.65
  
• d1lvl_1 appears in the current release, SCOPe 2.08, called d1lvla1