Lineage for d1lvl_1 (1lvl 1-150,266-335)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119214Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 119249Species Pseudomonas putida [TaxId:303] [51960] (1 PDB entry)
  8. 119250Domain d1lvl_1: 1lvl 1-150,266-335 [30567]
    Other proteins in same PDB: d1lvl_3

Details for d1lvl_1

PDB Entry: 1lvl (more details), 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution

SCOP Domain Sequences for d1lvl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvl_1 c.3.1.5 (1-150,266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida}
qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq
fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv
ldgkqvevdgqriqcehlllatgsssvelpXrrprtkgfnlecldlkmngaaiaidercq
tsmhnvwaigdvagepmlahramaqgemvaeiiagkarrfe

SCOP Domain Coordinates for d1lvl_1:

Click to download the PDB-style file with coordinates for d1lvl_1.
(The format of our PDB-style files is described here.)

Timeline for d1lvl_1: