![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species) |
![]() | Species Pseudomonas putida [TaxId:303] [419390] (1 PDB entry) |
![]() | Domain d1lvla1: 1lvl A:1-150,A:266-335 [30567] Other proteins in same PDB: d1lvla2, d1lvla3 complexed with fad, nad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1lvl (more details), 2.45 Å
SCOPe Domain Sequences for d1lvla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Pseudomonas putida [TaxId: 303]} qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv ldgkqvevdgqriqcehlllatgsssvelpXrrprtkgfnlecldlkmngaaiaidercq tsmhnvwaigdvagepmlahramaqgemvaeiiagkarrfe
Timeline for d1lvla1: