Lineage for d3k4da3 (3k4d A:274-601)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083909Species Escherichia coli [TaxId:83333] [272137] (8 PDB entries)
  8. 2083914Domain d3k4da3: 3k4d A:274-601 [305667]
    Other proteins in same PDB: d3k4da1, d3k4da2, d3k4da4, d3k4db1, d3k4db2, d3k4db4
    automated match to d5czkb3
    complexed with eva

Details for d3k4da3

PDB Entry: 3k4d (more details), 2.39 Å

PDB Description: crystal structure of e. coli beta-glucuronidase with the glucaro-d- lactam inhibitor bound
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d3k4da3:

Sequence, based on SEQRES records: (download)

>d3k4da3 c.1.8.0 (A:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik
eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht
dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl
hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr
drkpksaafllqkrwtgmnfgekpqqgg

Sequence, based on observed residues (ATOM records): (download)

>d3k4da3 c.1.8.0 (A:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgkpkelyseeavngetqqahlqaikeliardk
nhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdahtdtisdlf
dvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlaglhsmytdm
wseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftrdrkpksa
afllqkrwtgmnfgekpqqgg

SCOPe Domain Coordinates for d3k4da3:

Click to download the PDB-style file with coordinates for d3k4da3.
(The format of our PDB-style files is described here.)

Timeline for d3k4da3:

  • d3k4da3 is new in SCOPe 2.06-stable