![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
![]() | Domain d3k4da2: 3k4d A:182-273 [305666] Other proteins in same PDB: d3k4da1, d3k4da3, d3k4da4, d3k4db1, d3k4db3, d3k4db4 automated match to d5czkb2 complexed with eva |
PDB Entry: 3k4d (more details), 2.39 Å
SCOPe Domain Sequences for d3k4da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4da2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d3k4da2:
![]() Domains from other chains: (mouse over for more information) d3k4db1, d3k4db2, d3k4db3, d3k4db4 |