Lineage for d3k4ab1 (3k4a B:1-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775161Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2775208Domain d3k4ab1: 3k4a B:1-181 [305661]
    Other proteins in same PDB: d3k4aa2, d3k4aa3, d3k4aa4, d3k4ab2, d3k4ab3, d3k4ab4
    automated match to d5czkb1

Details for d3k4ab1

PDB Entry: 3k4a (more details), 2.9 Å

PDB Description: crystal structure of selenomethionine substituted e. coli beta- glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d3k4ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4ab1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyvgnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n

SCOPe Domain Coordinates for d3k4ab1:

Click to download the PDB-style file with coordinates for d3k4ab1.
(The format of our PDB-style files is described here.)

Timeline for d3k4ab1: