| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
| Domain d3k4aa1: 3k4a A:1-181 [305657] Other proteins in same PDB: d3k4aa2, d3k4aa3, d3k4aa4, d3k4ab2, d3k4ab3, d3k4ab4 automated match to d5czkb1 |
PDB Entry: 3k4a (more details), 2.9 Å
SCOPe Domain Sequences for d3k4aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4aa1 b.18.1.0 (A:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyvgnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n
Timeline for d3k4aa1:
View in 3DDomains from other chains: (mouse over for more information) d3k4ab1, d3k4ab2, d3k4ab3, d3k4ab4 |