SCOPe 2.05: Domain d1joaa2: 1joa A:120-242

Lineage for d1joaa2 (1joa A:120-242)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH peroxidase [51955] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)

8. Domain d1joaa2: 1joa A:120-242 [30564]
   Other proteins in same PDB: d1joaa3
   complexed with fad

Details for d1joaa2

PDB Entry: 1joa, 2.8 Å

PDB Description: nadh peroxidase with cysteine-sulfenic acid

PDB Compounds: (A:) nadh peroxidase

SCOPe Domain Sequences for d1joaa2:

Sequence; same for both SEQRES and ATOM records:

>d1joaa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

Timeline for d1joaa2:

• d1joaa2 first appeared (with stable ids) in SCOP 1.55, called d1joa_2
  
• d1joaa2 appears in SCOPe 2.04
  
• d1joaa2 appears in SCOPe 2.06
  
• d1joaa2 appears in the current release, SCOPe 2.08