Lineage for d1joa_2 (1joa 120-242)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119328Protein NADH peroxidase [51955] (1 species)
  7. 119329Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 119345Domain d1joa_2: 1joa 120-242 [30564]
    Other proteins in same PDB: d1joa_3

Details for d1joa_2

PDB Entry: 1joa (more details), 2.8 Å

PDB Description: nadh peroxidase with cysteine-sulfenic acid

SCOP Domain Sequences for d1joa_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joa_2 c.3.1.5 (120-242) NADH peroxidase {Enterococcus faecalis}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

SCOP Domain Coordinates for d1joa_2:

Click to download the PDB-style file with coordinates for d1joa_2.
(The format of our PDB-style files is described here.)

Timeline for d1joa_2: