Lineage for d3j9tu1 (3j9t U:11-81)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3023861Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) (S)
    automatically mapped to Pfam PF00137
  5. 3023862Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)
  6. 3023882Protein V-type proton ATPase subunit c [310715] (1 species)
  7. 3023883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310960] (1 PDB entry)
    also 3j9t chain a:, not included because SCOP sids are not case sensitive
  8. 3023890Domain d3j9tu1: 3j9t U:11-81 [305630]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_

Details for d3j9tu1

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (U:) V-type proton ATPase subunit C

SCOPe Domain Sequences for d3j9tu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tu1 f.17.1.1 (U:11-81) V-type proton ATPase subunit c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ffgaigcasaiiftslgaaygtaksgvgicatcvlrpdllfknivpvimagiiaiyglvv
svlvcyslgqk

SCOPe Domain Coordinates for d3j9tu1:

Click to download the PDB-style file with coordinates for d3j9tu1.
(The format of our PDB-style files is described here.)

Timeline for d3j9tu1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3j9tu2
View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2