Lineage for d3j9tq_ (3j9t Q:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580561Fold f.40: V-type ATP synthase subunit C [103485] (1 superfamily)
    9 transmembrane helices
  4. 2580562Superfamily f.40.1: V-type ATP synthase subunit C [103486] (1 family) (S)
    duplication: consists of three similar structural parts
    automatically mapped to Pfam PF01992
  5. 2580563Family f.40.1.1: V-type ATP synthase subunit C [103487] (2 protein domains)
  6. 2580570Protein V-type proton ATPase subunit d [310714] (1 species)
  7. 2580571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310959] (1 PDB entry)
  8. 2580572Domain d3j9tq_: 3j9t Q: [305623]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tq_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (Q:) V-type proton ATPase subunit D

SCOPe Domain Sequences for d3j9tq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tq_ f.40.1.1 (Q:) V-type proton ATPase subunit d {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
megvyfnidngfiegvvrgyrngllsnnqyinltqcdtledlklqlsstdygnflssvss
eslttsliqeyassklyhefnyirdqssgstrkfmdyitygymidnvalmitgtihdrdk
geilqrchplgwfdtlptlsvatdleslyetvlvdtplapyfkncfdtaeelddmnieii
rnklykayledfynfvteeipepakecmqtllgfeadrrsinialnslqssdidpdlksd
llpnigklyplatfhlaqaqdfegvraalanvyeyrgfletgnledhfyqlemelcrdaf
tqqfaistvwawmkskeqevrnitwiaeciaqnqrerinnyisvy

SCOPe Domain Coordinates for d3j9tq_:

Click to download the PDB-style file with coordinates for d3j9tq_.
(The format of our PDB-style files is described here.)

Timeline for d3j9tq_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2