Lineage for d3j9to_ (3j9t O:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223472Fold e.57: Vacuolar ATP synthase subunit C [118202] (1 superfamily)
    2 alpha+beta (sub)domains [each has a ferredoxin-like fold; (54861)], connected with 3-helical bundle; duplication: two repeats of beta-alpha-beta-[alpha coiled-coil]-beta-alpha-beta motif
  4. 2223473Superfamily e.57.1: Vacuolar ATP synthase subunit C [118203] (1 family) (S)
    automatically mapped to Pfam PF03223
  5. 2223474Family e.57.1.1: Vacuolar ATP synthase subunit C [118204] (1 protein)
    Pfam PF03223
  6. 2223475Protein Vacuolar ATP synthase subunit C [118205] (1 species)
  7. 2223476Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118206] (2 PDB entries)
    Uniprot P31412
    also 3j9t chain b:, not included because SCOP sids are not case sensitive
  8. 2223478Domain d3j9to_: 3j9t O: [305621]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9to_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (O:) V-type proton ATPase subunit C

SCOPe Domain Sequences for d3j9to_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9to_ e.57.1.1 (O:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
matalytandfilislpqnaqpvtapgsktdswfnetliggrafvsdfkipefkigsldt
liveseelskvdnqigasigkiieilqglnetstnayrtlpinnmpvpeylenfqwqtrk
fkldksikdlitlisnessqldadvratyanynsaktnlaaaerkktgdlsvrslhdivk
pedfvlnsehlttvlvavpkslksdfeksyetlsknvvpasasviaedaeyvlfnvhlfk
knvqefttaarekkfiprefnyseelidqlkkehdsaasleqslrvqlvrlaktayvdvf
inwfhikalrvyvesvlryglpphfnikiiavppknlskckselidafgflggnafmkdk
kgkinkqdtslhqyaslvdteyepfvmyiinl

SCOPe Domain Coordinates for d3j9to_:

Click to download the PDB-style file with coordinates for d3j9to_.
(The format of our PDB-style files is described here.)

Timeline for d3j9to_:

  • d3j9to_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2