Lineage for d3j9tn_ (3j9t N:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152108Fold c.149: AtpF-like [159467] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2152109Superfamily c.149.1: AtpF-like [159468] (1 family) (S)
    automatically mapped to Pfam PF01990
  5. 2152110Family c.149.1.1: AtpF-like [159469] (2 protein domains)
    Pfam PF01990; segment-swapping in some members
  6. 2152111Protein V-type ATP synthase subunit F, AtpF [159470] (4 species)
  7. 2152115Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310958] (1 PDB entry)
  8. 2152116Domain d3j9tn_: 3j9t N: [305620]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tn_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (N:) V-type proton ATPase subunit F

SCOPe Domain Sequences for d3j9tn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tn_ c.149.1.1 (N:) V-type ATP synthase subunit F, AtpF {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhfteer
ddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklf

SCOPe Domain Coordinates for d3j9tn_:

Click to download the PDB-style file with coordinates for d3j9tn_.
(The format of our PDB-style files is described here.)

Timeline for d3j9tn_:

  • d3j9tn_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2