Lineage for d3j9tm_ (3j9t M:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2239862Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2240012Superfamily h.4.20: V-type ATPase central rotor subunit D [310580] (2 families) (S)
    Role similar to F1 ATP synthase gamma (c.49.2), but do not appear to be homologous
    Has 2 antiparallel beta strands in addition to coiled coils; see PubMed 25971514
  5. 2240013Family h.4.20.1: V1 ATP synthase D subunit [310620] (1 protein)
  6. 2240014Protein V1 ATP synthase D subunit [310713] (2 species)
  7. 2240015Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310953] (1 PDB entry)
  8. 2240016Domain d3j9tm_: 3j9t M: [305619]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tm_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (M:) V-type proton ATPase subunit D

SCOPe Domain Sequences for d3j9tm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tm_ h.4.20.1 (M:) V1 ATP synthase D subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vfptrmtlglmktklkganqgysllkrksealtkrfrditkriddakqkmgrvmqtaafs
laevsyatgenigyqvqesvstarfkvrarqenvsgvylsqfesyidpeindfrltglgr
ggqqvqrakeiysravetlvelaslqtafiildevikvtnrrvnaiehviiprtentiay
inseldeldreefyrlkkvqekkqnetakl

SCOPe Domain Coordinates for d3j9tm_:

Click to download the PDB-style file with coordinates for d3j9tm_.
(The format of our PDB-style files is described here.)

Timeline for d3j9tm_:

  • d3j9tm_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2