Lineage for d3j9tj_ (3j9t J:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040739Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 3040740Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)
  6. 3040741Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species)
  7. 3040742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310951] (1 PDB entry)
  8. 3040744Domain d3j9tj_: 3j9t J: [305615]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9ti1, d3j9ti2, d3j9tk1, d3j9tk2, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tj_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (J:) V-type proton ATPase subunit G

SCOPe Domain Sequences for d3j9tj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tj_ h.1.37.1 (J:) V-type ATPase peripheral stalk subunit G coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikps

SCOPe Domain Coordinates for d3j9tj_:

Click to download the PDB-style file with coordinates for d3j9tj_.
(The format of our PDB-style files is described here.)

Timeline for d3j9tj_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2