Lineage for d3j9th_ (3j9t H:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266888Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 2266889Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)
  6. 2266890Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species)
  7. 2266891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310951] (1 PDB entry)
  8. 2266892Domain d3j9th_: 3j9t H: [305612]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9ti1, d3j9ti2, d3j9tk1, d3j9tk2, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9th_

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (H:) V-type proton ATPase subunit G

SCOPe Domain Sequences for d3j9th_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9th_ h.1.37.1 (H:) V-type ATPase peripheral stalk subunit G coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikps

SCOPe Domain Coordinates for d3j9th_:

Click to download the PDB-style file with coordinates for d3j9th_.
(The format of our PDB-style files is described here.)

Timeline for d3j9th_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2