SCOPe 2.08: Domain d3j9tf1: 3j9t F:29-99

Lineage for d3j9tf1 (3j9t F:29-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins)

6. Protein V1 ATP synthase B subunit, domain 1 [310702] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310927] (1 PDB entry)

8. Domain d3j9tf1: 3j9t F:29-99 [305607]
   Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tf1

PDB Entry: 3j9t, 6.9 Å

PDB Description: yeast v-atpase state 1

PDB Compounds: (F:) V-type proton ATPase subunit B

SCOPe Domain Sequences for d3j9tf1:

Sequence; same for both SEQRES and ATOM records:

>d3j9tf1 b.49.1.2 (F:29-99) V1 ATP synthase B subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntvsgvngplvilekvkfpryneivnltlpdgtvrqgqvleirgdraivqvfegtsgidv
kkttveftges

Timeline for d3j9tf1:

• d3j9tf1 first appeared in SCOPe 2.06
  
• d3j9tf1 appears in SCOPe 2.07