Lineage for d3j9tc3 (3j9t C:135-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817843Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family) (S)
    PubMed 19893485
  5. 2817844Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)
  6. 2817850Protein V1 ATP synthase A subunit, bulge domain [310706] (2 species)
  7. 2817851Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310936] (1 PDB entry)
  8. 2817853Domain d3j9tc3: 3j9t C:135-212 [305598]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tc3

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (C:) V-type proton ATPase catalytic subunit A

SCOPe Domain Sequences for d3j9tc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tc3 b.84.5.1 (C:135-212) V1 ATP synthase A subunit, bulge domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rtikwqftpgkfqvgdhisggdiygsvfenslisshkillpprsrgtitwiapageytld
ekilevefdgkksdftly

SCOPe Domain Coordinates for d3j9tc3:

Click to download the PDB-style file with coordinates for d3j9tc3.
(The format of our PDB-style files is described here.)

Timeline for d3j9tc3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2