Lineage for d3j9tc2 (3j9t C:92-134,C:213-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112661Protein V1 ATP synthase A subunit, central domain [310703] (2 species)
  7. 2112662Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310930] (1 PDB entry)
  8. 2112664Domain d3j9tc2: 3j9t C:92-134,C:213-463 [305597]
    Other proteins in same PDB: d3j9ta1, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tc2

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (C:) V-type proton ATPase catalytic subunit A

SCOPe Domain Sequences for d3j9tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tc2 c.37.1.11 (C:92-134,C:213-463) V1 ATP synthase A subunit, central domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lsvelgpglmetiydgiqrplkaikeesqsiyiprgidtpaldXhtwpvrvprpvtekls
adyplltgqrvldalfpcvqggttcipgafgcgktvisqslskysnsdaiiyvgcgergn
emaevlmefpelytemsgtkepimkrttlvantsnmpvaareasiytgitlaeyfrdqgk
nvsmiadsssrwaealreisgrlgempadqgfpaylgaklasfyeragkavalgspdrtg
svsivaavspaggdfsdpvttatlgitqvfwgldkklaqrkhfpsintsvsysky

SCOPe Domain Coordinates for d3j9tc2:

Click to download the PDB-style file with coordinates for d3j9tc2.
(The format of our PDB-style files is described here.)

Timeline for d3j9tc2:

  • d3j9tc2 is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2