![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins) |
![]() | Protein V1 ATP synthase A subunit, C-terminal domain [310709] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310943] (1 PDB entry) |
![]() | Domain d3j9ta4: 3j9t A:464-616 [305592] Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2 |
PDB Entry: 3j9t (more details), 6.9 Å
SCOPe Domain Sequences for d3j9ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j9ta4 a.69.1.2 (A:464-616) V1 ATP synthase A subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnvlnkfydsnypefpvlrdrmkeilsnaeeleqvvqlvgksalsdsdkitldvatlike dflqqngystydafcpiwktfdmmrafisyhdeaqkavanganwskladstgdvkhavss skffepsrgekevhgefekllstmqerfaestd
Timeline for d3j9ta4:
![]() Domains from other chains: (mouse over for more information) d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9tg2, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2 |