Lineage for d2npx_1 (2npx 1-119,243-321)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119328Protein NADH peroxidase [51955] (1 species)
  7. 119329Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 119340Domain d2npx_1: 2npx 1-119,243-321 [30559]
    Other proteins in same PDB: d2npx_3

Details for d2npx_1

PDB Entry: 2npx (more details), 2.4 Å

PDB Description: nadh binding site and catalysis of nadh peroxidase

SCOP Domain Sequences for d2npx_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npx_1 c.3.1.5 (1-119,243-321) NADH peroxidase {Enterococcus faecalis}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp

SCOP Domain Coordinates for d2npx_1:

Click to download the PDB-style file with coordinates for d2npx_1.
(The format of our PDB-style files is described here.)

Timeline for d2npx_1: