| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
| Protein automated matches [310855] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311219] (20 PDB entries) |
| Domain d3ir2b_: 3ir2 B: [305585] automated match to d4xxoa_ complexed with cl, mg, zn |
PDB Entry: 3ir2 (more details), 2.25 Å
SCOPe Domain Sequences for d3ir2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir2b_ c.97.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnqrrgflanqaphkhgfle
grhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktari
yddqgraqeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgr
lrailqn
Timeline for d3ir2b_: