SCOP 1.73: Domain d1npxa2: 1npx A:120-242

Lineage for d1npxa2 (1npx A:120-242)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH peroxidase [51955] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)

8. Domain d1npxa2: 1npx A:120-242 [30558]
   Other proteins in same PDB: d1npxa3
   complexed with cyo, fad

Details for d1npxa2

PDB Entry: 1npx, 2.16 Å

PDB Description: structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution

PDB Compounds: (A:) nadh peroxidase

SCOP Domain Sequences for d1npxa2:

Sequence; same for both SEQRES and ATOM records:

>d1npxa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

Timeline for d1npxa2:

• d1npxa2 first appeared (with stable ids) in SCOP 1.55, called d1npx_2
  
• d1npxa2 was called d1npx_2 in SCOP 1.71
  
• d1npxa2 appears in SCOP 1.75
  
• d1npxa2 appears in the current release, SCOPe 2.08