SCOPe 2.08: Domain d3ilnb_: 3iln B:

Lineage for d3ilnb_ (3iln B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [311299] (1 PDB entry)

8. Domain d3ilnb_: 3iln B: [305571]
   automated match to d3azza_
   complexed with ca, gol

Details for d3ilnb_

PDB Entry: 3iln, 1.95 Å

PDB Description: x-ray structure of the laminarinase from rhodothermus marinus

PDB Compounds: (B:) Laminarinase

SCOPe Domain Sequences for d3ilnb_:

Sequence; same for both SEQRES and ATOM records:

>d3ilnb_ b.29.1.0 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]}
rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea
rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd
ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir
wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv
vdyvrvyrwve

Timeline for d3ilnb_:

• d3ilnb_ first appeared in SCOPe 2.06
  
• d3ilnb_ appears in SCOPe 2.07