Lineage for d3ilnb_ (3iln B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781256Species Rhodothermus marinus [TaxId:29549] [311299] (1 PDB entry)
  8. 2781258Domain d3ilnb_: 3iln B: [305571]
    automated match to d3azza_
    complexed with ca, gol

Details for d3ilnb_

PDB Entry: 3iln (more details), 1.95 Å

PDB Description: x-ray structure of the laminarinase from rhodothermus marinus
PDB Compounds: (B:) Laminarinase

SCOPe Domain Sequences for d3ilnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ilnb_ b.29.1.0 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]}
rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea
rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd
ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir
wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv
vdyvrvyrwve

SCOPe Domain Coordinates for d3ilnb_:

Click to download the PDB-style file with coordinates for d3ilnb_.
(The format of our PDB-style files is described here.)

Timeline for d3ilnb_: