Lineage for d3ilna_ (3iln A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052289Species Rhodothermus marinus [TaxId:29549] [311299] (1 PDB entry)
  8. 2052290Domain d3ilna_: 3iln A: [305570]
    automated match to d3azza_
    complexed with ca, gol

Details for d3ilna_

PDB Entry: 3iln (more details), 1.95 Å

PDB Description: x-ray structure of the laminarinase from rhodothermus marinus
PDB Compounds: (A:) Laminarinase

SCOPe Domain Sequences for d3ilna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ilna_ b.29.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea
rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd
ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir
wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv
vdyvrvyrwve

SCOPe Domain Coordinates for d3ilna_:

Click to download the PDB-style file with coordinates for d3ilna_.
(The format of our PDB-style files is described here.)

Timeline for d3ilna_: