![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Rhodothermus marinus [TaxId:29549] [311299] (1 PDB entry) |
![]() | Domain d3ilna_: 3iln A: [305570] automated match to d3azza_ complexed with ca, gol |
PDB Entry: 3iln (more details), 1.95 Å
SCOPe Domain Sequences for d3ilna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ilna_ b.29.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]} rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv vdyvrvyrwve
Timeline for d3ilna_: