Lineage for d3ikza1 (3ikz A:1-161)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860873Species Burkholderia pseudomallei [TaxId:320372] [189579] (3 PDB entries)
  8. 2860875Domain d3ikza1: 3ikz A:1-161 [305568]
    Other proteins in same PDB: d3ikza2
    automated match to d3k9wa_
    complexed with cod, gol, so4

Details for d3ikza1

PDB Entry: 3ikz (more details), 2.1 Å

PDB Description: Crystal structure of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3ikza1:

Sequence, based on SEQRES records: (download)

>d3ikza1 c.26.1.0 (A:1-161) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlgh
ypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmtps
dqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama

Sequence, based on observed residues (ATOM records): (download)

>d3ikza1 c.26.1.0 (A:1-161) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlgh
ypnvkvmgftgllkdfvrandarvivrglrafeyefqmagmnryllpdvetmfmtpsdqy
qfisgtivreiaqlggdvskfvfpsvekwltekvaama

SCOPe Domain Coordinates for d3ikza1:

Click to download the PDB-style file with coordinates for d3ikza1.
(The format of our PDB-style files is described here.)

Timeline for d3ikza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ikza2