Lineage for d3ikja3 (3ikj A:440-588)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717499Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)
  6. 2717500Protein A1 ATP synthase A subunit, C-terminal domain [310708] (2 species)
  7. 2717501Species Pyrococcus horikoshii OT3 [TaxId:70601] [310940] (1 PDB entry)
  8. 2717502Domain d3ikja3: 3ikj A:440-588 [305567]
    Other proteins in same PDB: d3ikja1, d3ikja2
    complexed with mpd, trs; mutant

Details for d3ikja3

PDB Entry: 3ikj (more details), 2.4 Å

PDB Description: structural characterization for the nucleotide binding ability of subunit a mutant s238a of the a1ao atp synthase
PDB Compounds: (A:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3ikja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikja3 a.69.1.2 (A:440-588) A1 ATP synthase A subunit, C-terminal domain {Pyrococcus horikoshii OT3 [TaxId: 70601]}
vdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillvarmlr
edylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvreeigrm
kferdvskirslidktneqfeelfkkyga

SCOPe Domain Coordinates for d3ikja3:

Click to download the PDB-style file with coordinates for d3ikja3.
(The format of our PDB-style files is described here.)

Timeline for d3ikja3: