![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins) |
![]() | Protein A1 ATP synthase A subunit, C-terminal domain [310708] (2 species) |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [310940] (1 PDB entry) |
![]() | Domain d3ikja3: 3ikj A:440-588 [305567] Other proteins in same PDB: d3ikja1, d3ikja2 complexed with mpd, trs; mutant |
PDB Entry: 3ikj (more details), 2.4 Å
SCOPe Domain Sequences for d3ikja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ikja3 a.69.1.2 (A:440-588) A1 ATP synthase A subunit, C-terminal domain {Pyrococcus horikoshii OT3 [TaxId: 70601]} vdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillvarmlr edylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvreeigrm kferdvskirslidktneqfeelfkkyga
Timeline for d3ikja3: