Lineage for d1nhs_2 (1nhs 120-242)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21046Protein NADH peroxidase [51955] (1 species)
  7. 21047Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 21055Domain d1nhs_2: 1nhs 120-242 [30556]
    Other proteins in same PDB: d1nhs_3

Details for d1nhs_2

PDB Entry: 1nhs (more details), 2.1 Å

PDB Description: an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide

SCOP Domain Sequences for d1nhs_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhs_2 c.3.1.5 (120-242) NADH peroxidase {Enterococcus faecalis}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

SCOP Domain Coordinates for d1nhs_2:

Click to download the PDB-style file with coordinates for d1nhs_2.
(The format of our PDB-style files is described here.)

Timeline for d1nhs_2: