Lineage for d3i1xb2 (3i1x B:174-311)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2506189Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2506190Protein automated matches [190205] (28 species)
    not a true protein
  7. 2506329Species Synechocystis sp. [TaxId:1148] [225878] (6 PDB entries)
  8. 2506333Domain d3i1xb2: 3i1x B:174-311 [305550]
    Other proteins in same PDB: d3i1xa1, d3i1xb1
    automated match to d1m98a2
    complexed with gol, raw; mutant

Details for d3i1xb2

PDB Entry: 3i1x (more details), 1.7 Å

PDB Description: Crystal structure of R155L mutant of Synechocystis orange carotenoid binding protein
PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d3i1xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1xb2 d.17.4.0 (B:174-311) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

SCOPe Domain Coordinates for d3i1xb2:

Click to download the PDB-style file with coordinates for d3i1xb2.
(The format of our PDB-style files is described here.)

Timeline for d3i1xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3i1xb1