Lineage for d1nhs_1 (1nhs 1-119,243-321)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67358Protein NADH peroxidase [51955] (1 species)
  7. 67359Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 67366Domain d1nhs_1: 1nhs 1-119,243-321 [30555]
    Other proteins in same PDB: d1nhs_3

Details for d1nhs_1

PDB Entry: 1nhs (more details), 2.1 Å

PDB Description: an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide

SCOP Domain Sequences for d1nhs_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhs_1 c.3.1.5 (1-119,243-321) NADH peroxidase {Enterococcus faecalis}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflccgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp

SCOP Domain Coordinates for d1nhs_1:

Click to download the PDB-style file with coordinates for d1nhs_1.
(The format of our PDB-style files is described here.)

Timeline for d1nhs_1: