![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein NADH peroxidase, N- and C-terminal domain [418946] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [419402] (8 PDB entries) |
![]() | Domain d1nhsa1: 1nhs A:1-119,A:243-321 [30555] Other proteins in same PDB: d1nhsa2, d1nhsa3 complexed with fad, so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nhs (more details), 2 Å
SCOPe Domain Sequences for d1nhsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhsa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase, N- and C-terminal domain {Enterococcus faecalis [TaxId: 1351]} mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflccgmqlylegkvkdvnsvry mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna rkqgrfavknleepvkpfp
Timeline for d1nhsa1: