![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (35 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [225878] (8 PDB entries) |
![]() | Domain d3i1wb2: 3i1w B:174-312 [305546] Other proteins in same PDB: d3i1wa1, d3i1wb1 automated match to d1m98a2 complexed with raw; mutant |
PDB Entry: 3i1w (more details), 2.65 Å
SCOPe Domain Sequences for d3i1wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i1wb2 d.17.4.0 (B:174-312) automated matches {Synechocystis sp. [TaxId: 1148]} epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln pegkiffvaidllaspkel
Timeline for d3i1wb2: