SCOPe 2.08: Domain d3i1wb1: 3i1w B:4-173

Lineage for d3i1wb1 (3i1w B:4-173)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
   multihelical; array

4. Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families)
   duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
   automatically mapped to Pfam PF09150

5. Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)

6. Protein automated matches [227037] (2 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries)

8. Domain d3i1wb1: 3i1w B:4-173 [305545]
   Other proteins in same PDB: d3i1wa2, d3i1wb2
   automated match to d1m98a1
   complexed with raw; mutant

Details for d3i1wb1

PDB Entry: 3i1w, 2.65 Å

PDB Description: Crystal structure of Y44S mutant of Synechocystis orange carotenoid binding protein

PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d3i1wb1:

Sequence, based on SEQRES records:

>d3i1wb1 a.175.1.1 (B:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaslemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records):

>d3i1wb1 a.175.1.1 (B:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaslemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvlrnavvdmgfria

Timeline for d3i1wb1:

• d3i1wb1 first appeared in SCOPe 2.06
  
• d3i1wb1 appears in SCOPe 2.07