![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
![]() | Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) ![]() duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
![]() | Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) |
![]() | Protein automated matches [227037] (2 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries) |
![]() | Domain d3i1vb1: 3i1v B:5-173 [305541] Other proteins in same PDB: d3i1va2, d3i1vb2 automated match to d1m98a1 complexed with gol, raw |
PDB Entry: 3i1v (more details), 1.65 Å
SCOPe Domain Sequences for d3i1vb1:
Sequence, based on SEQRES records: (download)
>d3i1vb1 a.175.1.1 (B:5-173) automated matches {Synechocystis sp. [TaxId: 1148]} idsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmqla enalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfvap ipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria
>d3i1vb1 a.175.1.1 (B:5-173) automated matches {Synechocystis sp. [TaxId: 1148]} idsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmqla enalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfvap ipagyqlsananavlatiqglesgqqitvlrnavvdmgfria
Timeline for d3i1vb1: