Lineage for d3hr7b_ (3hr7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872033Species Helicobacter pylori [TaxId:85962] [311198] (5 PDB entries)
  8. 2872035Domain d3hr7b_: 3hr7 B: [305530]
    automated match to d4y0aa_
    complexed with so4

Details for d3hr7b_

PDB Entry: 3hr7 (more details), 1.8 Å

PDB Description: Crystal structure of the shikimate kinase-sulfate complex from Helicobacter pylori
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d3hr7b_:

Sequence, based on SEQRES records: (download)

>d3hr7b_ c.37.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerekrplln
nltqakelfekrqalyeknasfiidargglnnslkqvlqfia

Sequence, based on observed residues (ATOM records): (download)

>d3hr7b_ c.37.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqllnnltqake
lfekrqalyeknasfiidargglnnslkqvlqfia

SCOPe Domain Coordinates for d3hr7b_:

Click to download the PDB-style file with coordinates for d3hr7b_.
(The format of our PDB-style files is described here.)

Timeline for d3hr7b_: