Lineage for d3hola3 (3hol A:24-130)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078525Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2078526Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2078527Family b.181.1.1: Handle domain of Transferrin binding protein TbpB-like [310639] (1 protein)
  6. 2078528Protein Handle domain of Transferrin binding protein TbpB [310778] (1 species)
  7. 2078529Species Actinobacillus pleuropneumoniae [TaxId:715] [311034] (3 PDB entries)
  8. 2078530Domain d3hola3: 3hol A:24-130 [305527]
    Other proteins in same PDB: d3hola1, d3hola2

Details for d3hola3

PDB Entry: 3hol (more details), 1.98 Å

PDB Description: The Structure of Intact Ap-TbpB (N and C lobes)
PDB Compounds: (A:) TbpB

SCOPe Domain Sequences for d3hola3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hola3 b.181.1.1 (A:24-130) Handle domain of Transferrin binding protein TbpB {Actinobacillus pleuropneumoniae [TaxId: 715]}
eeykdvetakkekeqlgelmepalgyvvkvpvssfenkkvdisdievitngnlddvpyka
nsskynypdiktkdsslqyvrsgyvidgehsgsnekgyvyykgnspa

SCOPe Domain Coordinates for d3hola3:

Click to download the PDB-style file with coordinates for d3hola3.
(The format of our PDB-style files is described here.)

Timeline for d3hola3:

  • d3hola3 is new in SCOPe 2.06-stable