| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) ![]() |
| Family b.1.16.0: automated matches [191666] (1 protein) not a true family |
| Protein automated matches [191265] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189832] (5 PDB entries) |
| Domain d3hn9c_: 3hn9 C: [305520] automated match to d2llla_ |
PDB Entry: 3hn9 (more details), 2 Å
SCOPe Domain Sequences for d3hn9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hn9c_ b.1.16.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sishsasatgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvl
kagqtvtiwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfkt
Timeline for d3hn9c_: