Lineage for d3hn9c_ (3hn9 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764999Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2765016Family b.1.16.0: automated matches [191666] (1 protein)
    not a true family
  6. 2765017Protein automated matches [191265] (1 species)
    not a true protein
  7. 2765018Species Human (Homo sapiens) [TaxId:9606] [189832] (5 PDB entries)
  8. 2765024Domain d3hn9c_: 3hn9 C: [305520]
    automated match to d2llla_

Details for d3hn9c_

PDB Entry: 3hn9 (more details), 2 Å

PDB Description: Crystal Structure of Lamin-B1
PDB Compounds: (C:) Lamin-B1

SCOPe Domain Sequences for d3hn9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hn9c_ b.1.16.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sishsasatgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvl
kagqtvtiwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfkt

SCOPe Domain Coordinates for d3hn9c_:

Click to download the PDB-style file with coordinates for d3hn9c_.
(The format of our PDB-style files is described here.)

Timeline for d3hn9c_: