Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [196426] (7 PDB entries) |
Domain d3hh9d_: 3hh9 D: [305511] automated match to d3o4fa_ |
PDB Entry: 3hh9 (more details), 2.85 Å
SCOPe Domain Sequences for d3hh9d_:
Sequence, based on SEQRES records: (download)
>d3hh9d_ c.66.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qwhetlhdqfgqyfavdnvlyhektdhqdliifenaafgrvmaldgvvqtterdefiyhe mmthvpllahghakhvliigggdgamlrevtrhknvesitmveidagvvsfcrqylpnhn agsyddprfklviddgvnfvnqtsqtfdviisdctdpigpgeslftsafyegckrclnpg gifvaqngvcflqqeeaidshrklshyfsdvgfyqaaiptyyggimtfawatdndalrhl steiiqarflasglkcryynpaihtaafalpqylqda
>d3hh9d_ c.66.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qwhetlhdqfgqyfavdnvlyhektdhqdliifenaafgrvmaldgvvqtterdefiyhe mmthvpllahghakhvliigggdgamlrevtrhknvesitmveidagvvsfcrqylpnhn agsyddprfklvivnqtsqtfdviisdctsafyegckrclnpggifvaqngvcflqqeea idshrklshyfsdvgfyqaaiptyyggimtfawatdndalrhlsteiiqarlkcryynpa ihtaafalpqylqda
Timeline for d3hh9d_: