SCOP 1.63: Domain d1hyua2: 1hyu A:326-451

Lineage for d1hyua2 (1hyu A:326-451)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [51954] (1 PDB entry)

8. Domain d1hyua2: 1hyu A:326-451 [30548]
   Other proteins in same PDB: d1hyua3, d1hyua4
   complexed with cl, fad, so4

Details for d1hyua2

PDB Entry: 1hyu, 2 Å

PDB Description: crystal structure of intact ahpf

SCOP Domain Sequences for d1hyua2:

Sequence; same for both SEQRES and ATOM records:

>d1hyua2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Salmonella typhimurium}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdkvrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihsvalagi
fvqigl

Timeline for d1hyua2:

• d1hyua2 first appeared (with stable ids) in SCOP 1.55
  
• d1hyua2 appears in SCOP 1.61
  
• d1hyua2 appears in SCOP 1.65
  
• d1hyua2 appears in the current release, SCOPe 2.08