![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
![]() | Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [51954] (1 PDB entry) |
![]() | Domain d1hyua2: 1hyu A:326-451 [30548] Other proteins in same PDB: d1hyua3, d1hyua4 |
PDB Entry: 1hyu (more details), 2 Å
SCOP Domain Sequences for d1hyua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyua2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Salmonella typhimurium} wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle fapemkadqvlqdkvrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihsvalagi fvqigl
Timeline for d1hyua2: