Lineage for d1hyua1 (1hyu A:199-325,A:452-521)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 239501Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 239502Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 239750Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 239751Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)
  7. 239755Species Salmonella typhimurium [TaxId:90371] [51954] (1 PDB entry)
  8. 239756Domain d1hyua1: 1hyu A:199-325,A:452-521 [30547]
    Other proteins in same PDB: d1hyua3, d1hyua4

Details for d1hyua1

PDB Entry: 1hyu (more details), 2 Å

PDB Description: crystal structure of intact ahpf

SCOP Domain Sequences for d1hyua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyua1 c.3.1.5 (A:199-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Salmonella typhimurium}
aekraaealnkrdaydvlivgsgpagaaaavysarkgirtglmgerfggqvldtvdieny
isvpktegqklagalkahvsdydvdvidsqsasklvpaategglhqietasgavlkarsi
iiatgakXlpnthwlegalernrmgeiiidakcetsvkgvfaagdcttvpykqiiiatge
gakaslsafdylirtkia

SCOP Domain Coordinates for d1hyua1:

Click to download the PDB-style file with coordinates for d1hyua1.
(The format of our PDB-style files is described here.)

Timeline for d1hyua1: